Protein Info for SO1665 in Shewanella oneidensis MR-1

Name: galU
Annotation: UTP-glucose-1-phosphate uridylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 6 to 275 (270 residues), 367.5 bits, E=2.1e-114
• PF00483: NTP_transferase
  • amino acids 8 to 279 (272 residues), 99.4 bits, E=2.5e-32

Best Hits

Swiss-Prot: 70% identical to GALU_SHIFL: UTP--glucose-1-phosphate uridylyltransferase (galU) from Shigella flexneri

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to son:SO_1665)

MetaCyc: 70% identical to UTP--glucose-1-phosphate uridylyltransferase (Escherichia coli K-12 substr. MG1655)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose biosynthesis II (6/8 steps found)
• D-galactose detoxification (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• stachyose degradation (3/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

See Q8EGD9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SO1665 UTP-glucose-1-phosphate uridylyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLKTDNLASMVSLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKEETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK