Protein Info for SO1639 in Shewanella oneidensis MR-1

Name: lpxD
Annotation: UDP-3-O-(3-hydroxymyristoyl) glucosamine n-acyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 12 to 329 (318 residues), 382.3 bits, E=7.9e-119
• PF04613: LpxD
  • amino acids 23 to 89 (67 residues), 87.8 bits, E=6.9e-29
• PF00132: Hexapep
  • amino acids 100 to 131 (32 residues), 27.7 bits, 3.2e-10
  • amino acids 110 to 143 (34 residues), 36.9 bits, 3.9e-13
  • amino acids 127 to 160 (34 residues), 35.3 bits, 1.3e-12
  • amino acids 145 to 179 (35 residues), 35.2 bits, 1.4e-12
• PF14602: Hexapep_2
  • amino acids 113 to 143 (31 residues), 21.8 bits, see alignment (E = 2.5e-08)
  • amino acids 147 to 179 (33 residues), 12.1 bits, 2.6e-05
  • amino acids 201 to 218 (18 residues), 13.4 bits, see alignment (E = 1.1e-05)
  • amino acids 259 to 275 (17 residues), 12.3 bits, see alignment (E = 2.3e-05)

Best Hits

Swiss-Prot: 100% identical to LPXD_SHEON: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to son:SO_1639)

MetaCyc: 52% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli K-12 substr. MG1655)
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-RXN [EC: 2.3.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (15/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (15/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

See Q8EGG5 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SO1639 UDP-3-O-(3-hydroxymyristoyl) glucosamine n-acyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKSVTLKELSLLLDGVVQGDETLVINSVATLEHATSGQISFLANSKYRAQLESTQASAVL
LSAKDAQDYQGTALVVKDPYVGFARVAQLLDTTPKAAMGIHPSAQIDPSAQLGDGVAIGA
NAVIGANVILGENVQIGAGTVIGQDSIIGSNTRLWANVTLYHNVHLGQDCIIHSGAIIGS
DGFGYANERGQWIKIPQTGGVRIGDRVEIGANSTIDRGALGHTEIHNGVIIDNQVQVAHN
DIIGENTAIAGSTTIAGSVTIGKHCIIGGNCAIAGHLTIADGVHLSGATNVTGNMREPGL
YSSATVAMDNNLWRKNTVRFRQLDELFQRVKAIEKNLNTPE