Protein Info for SO1636 in Shewanella oneidensis MR-1

Annotation: membrane-associated zinc metalloprotease, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 3 to 456 (454 residues), 446.7 bits, see alignment E=4e-138 PF02163: Peptidase_M50" amino acids 11 to 444 (434 residues), 261 bits, see alignment E=1.9e-81 PF00595: PDZ" amino acids 228 to 281 (54 residues), 24.4 bits, see alignment 7.8e-09 PF17820: PDZ_6" amino acids 231 to 283 (53 residues), 36.7 bits, see alignment 6.7e-13

Best Hits

Swiss-Prot: 52% identical to RSEP_SALTI: Regulator of sigma E protease (rseP) from Salmonella typhi

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to son:SO_1636)

MetaCyc: 52% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGG8 at UniProt or InterPro

Protein Sequence (456 amino acids)

>SO1636 membrane-associated zinc metalloprotease, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLDFLWNLGSFIVALGLLITAHEYGHFYVARRCGVKVERFSIGFGKTIWRKVGKDGTEYV
VAMIPLGGYVKMLDERVEDVPEELKDQAFNRKSVWQRIAIVAAGPIANFIFAIIALYFMY
LIGVPSLKPVITSTTPGSAAAQIKVNEPMQVTAISGQAVRNWEEVNLALVGHIGDDSLTV
SLAPLSGLQGLDTDTRTYTLDTRQWRFDPEKESPITTLGLGVYRPAIEPQIALISEGSAA
ANSDLKVGDTLVAINGQQYTDWQAFVDIIQHSANVPVELTVRRNGEQFAISVTPASIKNS
DGKEIGVLGVSPTQAQWPENMRLQLEYGPIDSFAIAADKTWQLVAVSFKMIGKLFTGDVS
VKNLSGPISIAQGAGNSANYGLVYFLGFLALISVNLGIINLLPLPVLDGGHLLYYFVEVI
TGKPVSEKVQEIGFRFGAALLLMLMSIALFNDFARL