Protein Info for SO1635 in Shewanella oneidensis MR-1

Name: dxr
Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 1 to 393 (393 residues), 508.2 bits, E=6.9e-157
• PF02670: DXP_reductoisom
  • amino acids 4 to 131 (128 residues), 142 bits, E=2.7e-45
• PF08436: DXP_redisom_C
  • amino acids 145 to 238 (94 residues), 122.6 bits, E=9.1e-40
• PF13288: DXPR_C
  • amino acids 270 to 386 (117 residues), 145.9 bits, E=9.3e-47

Best Hits

Swiss-Prot: 100% identical to DXR_SHEON: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to son:SO_1635)

MetaCyc: 60% identical to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate reductoisomerase. [EC: 1.1.1.267]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See Q8EGG9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>SO1635 1-deoxy-D-xylulose 5-phosphate reductoisomerase (NCBI ptt file) (Shewanella oneidensis MR-1)
MQNMVILGATGSIGASTLSVISANPTAYRVYALVANASVDKMLTLCLAHRPQVAHMVDHK
AALALKAQLPAALNIQVTSGEDELIALVTAPAVDTVMAAIVGAAGLVPTLAAVKAGKRVL
LANKEALVMSGELFIEATRASGATLLPVDSEHNAIFQCLPEEVQSNLGRCDLAASGISHI
LLTGSGGPFLTAELSNLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QKDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIRSGVEPLDFFK
VGQLSFCEPDFNRFPCLALAIEACSQGQEATTVLNAANEIAVEAFLQGKIGFTHIGKINE
DCLLSVPKQAMASIEDIIALDAQTRIYARELLAKFA