Protein Info for SO1536 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18125: RlmM_FDX
  • amino acids 1 to 71 (71 residues), 105 bits, E=3.4e-34
• PF21239: RLMM_N
  • amino acids 84 to 162 (79 residues), 123.1 bits, E=6e-40
• PF01728: FtsJ
  • amino acids 185 to 279 (95 residues), 43 bits, E=7.7e-15

Best Hits

Swiss-Prot: 100% identical to RLMM_SHEON: Ribosomal RNA large subunit methyltransferase M (rlmM) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 100% identity to son:SO_1536)

MetaCyc: 59% identical to 23S rRNA 2'-O-ribose C2498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11589 [EC: 2.1.1.186]

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.186

Sequence Analysis Tools

See Q8EGQ9 at UniProt or InterPro

Protein Sequence (361 amino acids)

>SO1536 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKNLFLFCRAGYEKECAAEIQQRAAELNVGGFVKTNNNDAYVVYQCFEDDGADTLVKQLP
LDSLIFARQMFAASELLADLPESDRVSPIVAALSEVSKAGELRVETPDTNEAKELSAFCR
KFTVPLRQHLKKSGSLLAQENPKRPIIHVCFIGPGRAYAGYSLSNNSSPNFMGIPRLKMA
ADAPSRSSLKLDEAFAQFVPKEEQEERVRSGMNAVDLGACPGGWTYQLVRRGMFVSAVDN
GPMNEKLMETGQVKHFREDGFRFEPQRKNIYWLVCDMVEKPARVAELIEAWAINGWFKEA
IFNLKLPMKSRYKEVMAILNTMQDILKENGITEFKLQCKHLYHDRDEVTVHLWLKPSQPW
N