Protein Info for SO1522 in Shewanella oneidensis MR-1

Updated annotation (from data): D,L-lactate/pyruvate symporter LctP2
Rationale: Important for utilization of L-lactate, D,L-lactate, or pyruvate. Has phenotypes in many nitrogen source experiments with D,L-lactate as the carbon source. Also see PMID:28285200 for evidence that LctP2 transports D-lactate.
Original annotation: L-lactate permease, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 198 to 225 (28 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 280 (18 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 399 to 416 (18 residues), see Phobius details amino acids 418 to 419 (2 residues), see Phobius details amino acids 422 to 438 (17 residues), see Phobius details amino acids 440 to 468 (29 residues), see Phobius details amino acids 489 to 515 (27 residues), see Phobius details amino acids 527 to 545 (19 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 4 to 543 (540 residues), 341.2 bits, see alignment E=6.2e-106 PF02652: Lactate_perm" amino acids 7 to 543 (537 residues), 347 bits, see alignment E=1.1e-107

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to son:SO_1522)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGS2 at UniProt or InterPro

Protein Sequence (547 amino acids)

>SO1522 D,L-lactate/pyruvate symporter LctP2 (Shewanella oneidensis MR-1)
MTILQLFASLTPVLSVMIFLVLLRMPASKAMPISMVVTAIAAVFIWQMDTTLLAASVVEG
LLSAITPLTIIFGAVFLLNTLKYSGAMDTIRAGFTNISADARVQVIIICWLFGAFIEGSA
GFGTPAAIGAPLLVLLGVPPVAAAVVALIADSACVSFGAIGLPVLFGMEQGLIQGGVSMA
AEQFAAHGGTYAGYARYIVMHMITIDLITGTLIPLVMVTMLTGFFGRNKSFKEGLAIWKF
AIFSGLAFTVPAWIINYLAGPEFPSVIGALIGMAMVIPVARKGYLLPKTPWNDFAENDNQ
DGVKLETTAKFSQIAAWTPYIIMAALLVLSRTVAPLKAWLSGFNINWTGLLGTELKASFA
TLYAPGAFFVAVCILGFFLFKMKSPAIKQSIGVSCKSMLPTIISLGASVPMVKIFLNSGA
NGAGLASMPVALADMLASSMGAVWAWMAPIVGIFGAFLSGSATFSNMMFSSLQYSVADNI
GMNHTLVLALQGIGANAGNMMCVMNVVAAATVVGMAGRESEIIRKTMPVAIGYALLAGTI
ATLWGGF