Protein Info for SO1520 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02754: CCG" amino acids 3 to 83 (81 residues), 47.5 bits, see alignment E=7.7e-17 amino acids 132 to 224 (93 residues), 46.3 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to shw:Sputw3181_2836)

MetaCyc: 100% identical to L-lactate dehydrogenase LldE subunit (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGS4 at UniProt or InterPro

Protein Sequence (247 amino acids)

>SO1520 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKIALFIPCLVNQMMPDVAIATLELLEKLGHQVILPAGQTCCGQPMTNSGCFDAARSTTL
KLLNAFKGVECDAIVCPAASCLVAAKENFHEFDNSPEAQAVINKLYELTEFLHDIAPIPA
FNKPFAHKISLQLSCHGIRMLSLATPSEQMGPRFNKVEAVLANIAGIDIVYPDRRDECCG
FGGTFAVDEGAVSAKMGKDKAQAHAATGAQYVVGFDPSCLLHLDGLIRRQQLPIEIRHIA
QVLNAAL