Protein Info for SO1519 in Shewanella oneidensis MR-1

Annotation: iron-sulfur cluster-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF02589: LUD_dom" amino acids 75 to 293 (219 residues), 145.4 bits, see alignment E=7.1e-46 PF13237: Fer4_10" amino acids 307 to 371 (65 residues), 32.8 bits, see alignment E=2.2e-11 PF13183: Fer4_8" amino acids 310 to 374 (65 residues), 54.3 bits, see alignment E=6.4e-18 PF12838: Fer4_7" amino acids 312 to 374 (63 residues), 32.4 bits, see alignment E=4.2e-11 PF13534: Fer4_17" amino acids 312 to 374 (63 residues), 35.3 bits, see alignment E=5.4e-12

Best Hits

Swiss-Prot: 39% identical to LUTB_LYSSC: Lactate utilization protein B (lutB) from Lysinibacillus sphaericus (strain C3-41)

KEGG orthology group: None (inferred from 100% identity to son:SO_1519)

MetaCyc: 100% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGS5 at UniProt or InterPro

Protein Sequence (464 amino acids)

>SO1519 iron-sulfur cluster-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAYQHNHEAMGSQVHAYKADIFCRDETRVDWHSKALWLLREKRDRAAGSLPEWEQLRQLG
SEIKLHTLTNLAQYLETFEQNCLANGIKVHWAKDGAEHNRIVHEILASHKVKKLVKSKSM
LTEECHLNPYLEQRGIEVIDTDLGERIIQLAKMPPSHIVVPAIHMKKEEVGDLFHDKLGT
KAGESDPLYLTRAARAHLREQFLSADAAMTGVNMAIADKGAVVVCTNEGNADMGANLPKL
QLHSMGIDKVVPDIDSAAVLLRTLARNATGQPVTTYSAFYRGPQVDGEMHVIIVDNGRTE
MMKDKILAESLKCIRCGGCLNTCPVYRRSGGYSYNYTIPGPIGIAVGATHDNTNSIAWAC
TLCGSCTYVCPTKVPLDKIIHHHRRLKAEAGKLPYGKNAYMPLVGKFMASTTLLNCSMGA
ARTALRILPGSLLKPFSGAWGKYRELPVAPNSSFEAWFKKHRSL