Protein Info for SO1505 in Shewanella oneidensis MR-1

Annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 113 to 140 (28 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 398 to 416 (19 residues), see Phobius details amino acids 480 to 500 (21 residues), see Phobius details PF07690: MFS_1" amino acids 62 to 411 (350 residues), 97.5 bits, see alignment E=4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1505)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGT6 at UniProt or InterPro

Protein Sequence (514 amino acids)

>SO1505 transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSHNSPNAENDLREVKQLGMWASITSLSYIFWLVGGMELVERIAYYGVKASAGLYAKAPE
SAGGLGISLSDYGIIISLWAIMQTFVPVFTGGISDRVGYKETIFGSTIIKIMGYLTMAFF
PTFWGFLSGSLLLAIGTGIFKPGIQGTLVLSTNRNNTSMAWGIFYQVVNIGGFLGPLVAV
HMRQLSWDNVFYACAAIISLNFLFLLTYTEPGKAERLARNQQIKSGDIKQETLWRDAWHE
LKKPIVIYYMLVFSGFWFLFNSLFDVLPIHISEWVDTSVIVTSLFGSEGTSNGILQFWLG
LNNEGTKVMPEGMLNLNAGLIMTSCFLVAALTAKYRITTVMLIGCLLSILAFVFIGAFHA
AWFIVFAIAMFSIGEMMISPKKNEFMGNIAPEGKKAMYLGFVMLPQGIGWGLEGYFGPKL
YEIYASKELFSRDLLLERGMSPTDVSAIPQGEAFTTLVSFTGENAHDLTQLLYNSHNIGM
AWYIIAAIGTISAVGIYFYGKWLLTLQRAQQAAH