Protein Info for SO1428 in Shewanella oneidensis MR-1

Annotation: outer membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03509: decaheme-associated outer membrane protein, MtrB/PioB family" amino acids 52 to 661 (610 residues), 707.8 bits, see alignment E=7.4e-217 PF11854: MtrB_PioB" amino acids 60 to 660 (601 residues), 758.9 bits, see alignment E=2.4e-232

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1428)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH04 at UniProt or InterPro

Protein Sequence (662 amino acids)

>SO1428 outer membrane protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSFKLNIITLGLLAATSGVSAADFSVHKANLQGLKLDAYQCKSCIGEKRYQGELQLSAGW
AENDDIHAGNAFGDASDGMRAAMDADVRYRNAGYEANVQAYQLGLENSYAHLDAGRSGQY
ALNLDYQLLTRYDSRAQTQLWHNNGVLLPDTATRDVDLQLEREKVGLGLAAQYGVMQAFI
NYDHEQKTGNRRSSLVTPRPVNFALPVDANTENLNAGLNISGENWLSELAYHGSFYRNNI
DNLSLPYLPDVYAATPDNDAHQVSLSGQYMLGRGTVNGRVAAGRMLQDGDLIQVSGNPLQ
SWDAQVDTLDARLGFSNMLSPRWRVNGQVDYSERDNKSSVWEFAQLEFDNVSGAFKQNVP
MDIERLTYKLHSSYRFNSQYRLMGGYDRKEVERSYLEREQTHDDAFWAKLNIRALPNTVI
DFGGRYENRSGSVYNAVENTSIEENPLLRKFYLADRERQAVELKANYVPLSWLTLDLNGY
YAKDDYAKTIIGLTESTDYGYDLQLGMQLSEQLHLYASASQQWIDSAIAGSQSFSSPDWY
SDIADEFINLGAGFTYSGLLDDRLTLGGNYLFSNSASDSLISYNEVQPYGDYYSYNHSVE
LYGRYALSERMGLKLSYQYERYYDTDYSQSAVNSIPGLITLGDLNHNYNAHLLMFTFSYL
LP