Protein Info for SO1405 in Shewanella oneidensis MR-1

Annotation: transglutaminase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01841: Transglut_core" amino acids 164 to 292 (129 residues), 76.1 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 61% identical to Y1048_HAEIN: Uncharacterized protein HI_1048 (HI_1048) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_1405)

Predicted SEED Role

"Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH26 at UniProt or InterPro

Protein Sequence (379 amino acids)

>SO1405 transglutaminase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQRRDFLKGAAILSAAGIVMPVLAASTQTSAVTDKGVGRRRFTLTNTYQLAAPEGSSGVV
KLWVPLPENTAFQQVEKLNFSGTYQDAYISANNHYGAKTLFATWPDAKGKMTLTLELVIE
TQDWEPLKSGELSHYRAPAKPEYPAEVAIYLKPTKHMPVDGIVKQTADKIVGKETEPLKQ
AQLIYNWVSANMYRDNSVIGCGNGDVAAILESGKLGGKCTDINSVFVALMRAVGVPAREM
FGIRLGQAIKMGKYSKKAFGSADEKGVADVTGGQHCRAMFYLAGYGWLPADPADVTKMRL
TENKEHSDPAVQAVNDYLFGNWEMNWIGFNYGRDFDLFPAAEQTPLNNFGYPYAEVDGDP
VNYYEPKVFAYDYQSSEQR