Protein Info for SO1385 in Shewanella oneidensis MR-1

Annotation: methyl-accepting chemotaxis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 157 to 194 (38 residues), see Phobius details PF00989: PAS" amino acids 27 to 114 (88 residues), 44 bits, see alignment E=5.3e-15 PF08448: PAS_4" amino acids 27 to 118 (92 residues), 25 bits, see alignment E=4.7e-09 TIGR00229: PAS domain S-box protein" amino acids 28 to 120 (93 residues), 56.3 bits, see alignment E=1.7e-19 PF13426: PAS_9" amino acids 30 to 117 (88 residues), 43.3 bits, see alignment E=9.4e-15 PF08447: PAS_3" amino acids 38 to 121 (84 residues), 68.6 bits, see alignment E=1.2e-22 PF00015: MCPsignal" amino acids 323 to 486 (164 residues), 122.5 bits, see alignment E=4.5e-39

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to son:SO_1385)

Predicted SEED Role

"Methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH45 at UniProt or InterPro

Protein Sequence (520 amino acids)

>SO1385 methyl-accepting chemotaxis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLSNPSRSKITHSNAQEIRLTPQDELISTTNTRGIITYVNQRFAEVSGYSADELIGHPH
NKVRHPDMPSAAFKEMWEKLKSGQSWRGIVKNRCKNGDFYWVDAFVSPIFENGTIVGYQS
VRLQPQAAYVSKATAIYRRLLHNKPIPKPLSLMQKRAVSAVVASTGLLIAGYFWGWGVII
AGAILMGLNLAIFYDEAFRIPAKLIDMQTKYDSISRYIYAGADTSSILDFQLILLQAKMN
GVLGRTQDQANQLHAIADQLVVTTEQTYASLDQEKNQLEQLASAMEEMSSTITEVAQNTQ
RTSTSINTAYELCLKSSANMKANTQKVEQLAKSVADAANNANLLNQEAERVASAMGEIDS
IAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALSSRTQLSTNSISQSVDKMFSMLNA
WAKEMEQSRQHAERCANDIQTSAENVNTIYQEVSEIHTFAQQNAVAADQQRQVVHEITNN
IHFITQSSSENLAATHQIGDAANHLKHNAEKALGLRRAFG