Protein Info for SO1366 in Shewanella oneidensis MR-1

Annotation: sodium/hydrogen exchanger family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 48 (17 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 234 to 251 (18 residues), see Phobius details amino acids 256 to 273 (18 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 33 to 414 (382 residues), 180.4 bits, see alignment E=2.6e-57

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 100% identity to son:SO_1366)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH64 at UniProt or InterPro

Protein Sequence (434 amino acids)

>SO1366 sodium/hydrogen exchanger family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTSYQILCILSALALVTSVASSRLHKLQETVAITALALGTSLLLLLGGKALGGNVYGYFV
AGLEKLDFQALLLNGMLGFLLFAGALQIRLKILRHQKWEILILAFVGTLLSTFIVGGLLY
YLAPMFGLPLALSHCLLFGALISPTDPIAVLAILKKMGAPEDIAIQVEGESLFNDGIGLV
IFVAISHLAFSTEPLTFTQISLLFVQEALGGVLYGAVLGLLLHHFFRYCEEETQLMLVTL
LIPTAGYVMAAELGVSGPLAMVSAGIIIGNYSVPKFFARQERVKLYTFWSLIESFFNALL
FLLLGLLLLLVTFKAPLWWFMLLAIPLVLTARAVSVFLPYMGFRLVKSYNPYAESILIWG
GLRGGLALAMAMSLPKGIIIDSQPGVELHELVLVMTYAVVVFSILIQGSSMTGLIRRSNA
VVTRPDSHTTQESR