Protein Info for SO1364 in Shewanella oneidensis MR-1

Annotation: iron-sulfur cluster-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00970: FAD_binding_6" amino acids 3 to 74 (72 residues), 46.4 bits, see alignment E=6.5e-16 PF00175: NAD_binding_1" amino acids 85 to 196 (112 residues), 46.9 bits, see alignment E=5.9e-16 PF00111: Fer2" amino acids 256 to 317 (62 residues), 47.3 bits, see alignment E=2.4e-16

Best Hits

KEGG orthology group: K11933, NADH oxidoreductase Hcr [EC: 1.-.-.-] (inferred from 100% identity to son:SO_1364)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH66 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SO1364 iron-sulfur cluster-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFDYKPGQFITFVLEINGEQACRSYTLSSTPSRPYSLMVTIKRVDGGLVSNYLIDHLQP
GQTVRVLPPTGQFNLFDIPANKYLFLSAGCGITPMYSMSRYLTDTQINADIAVVHSARTQ
ADIIFKNTLETMAARHASFKLCYLVEGVTTDTVWHTEEAFHYVGRLSAQNLLSLVPDFAE
RIVFLCGPELYMQAVKTILTELNFDMNKLYHESFATAVKEAQSHVKQAEIQSETPTTSST
GFMLSIGDKKHLLTAEQTLLDGIEAEGLPIIAACRSGVCGACKCKVLQGETESTSYMTLT
PTDIEAGYVLACSTRLKSDVTLSLI