Protein Info for SO1363 in Shewanella oneidensis MR-1

Name: hcp
Annotation: prismane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR01703: hydroxylamine reductase" amino acids 1 to 551 (551 residues), 751.2 bits, see alignment E=2.8e-230 PF03063: Prismane" amino acids 1 to 548 (548 residues), 536 bits, see alignment E=5e-165

Best Hits

Swiss-Prot: 100% identical to HCP_SHEON: Hydroxylamine reductase (hcp) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_1363)

MetaCyc: 64% identical to protein S-nitrosylase (Escherichia coli K-12 substr. MG1655)
Hydroxylamine reductase. [EC: 1.7.99.1]

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH67 at UniProt or InterPro

Protein Sequence (554 amino acids)

>SO1363 prismane protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFCIQCEQTIRTPAGNGCSYAQGMCGKLAATSDLQDLLIYMLQGVSVYAVKARELGVVDT
EVDTFVPKAFFSTLTNVNFDDERIIAYAKQAAQYRESLKNAYEATCEQSGKTAEQMPPVA
QLVLGTSKLEMLSQAPISLLNKDKNNIHEDILGLRLLCLYGLKGAAAYMEHARVLGKTDV
DIAADFHRIMAFLGEPSVDADKLFSTAMEIGQLNYRIMALLDAGETEAFGHPEPTVVNTK
PVKGKAILVSGHDMKDLELILEQTAGKGINVYTHGEMLPALAYPAFKKYPHLVGNYGSAW
QNQQKEFANFPGAVVMTSNCIIDPNVGQYSDRIFTRSIVGWPGVVHVTGDDFSVVIEKAL
SNDGFHYDEIPHNITIGFARNALMAAAPTVVENVKNGSIKHFFLVGGCDGDKSERSYFTD
LAKSAPKDSIILTLGCGKYKFNKLEFGDINGIPRLLDIGQCNDAYSAIQLAIALSQIFEC
DINELPLNLVLSWFEQKAIVVLLTLLSLGVKNIRTGPTPPAFLTANLAKILEDKFGLRNT
TTVEADLKTMLNVA