Protein Info for SO1359 in Shewanella oneidensis MR-1

Name: trmD
Annotation: tRNA (guanine-N1)-methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 1 to 233 (233 residues), 356.5 bits, see alignment E=2.6e-111 PF01746: tRNA_m1G_MT" amino acids 1 to 225 (225 residues), 325 bits, see alignment E=1.1e-101

Best Hits

Swiss-Prot: 100% identical to TRMD_SHEON: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 100% identity to son:SO_1359)

MetaCyc: 80% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CX44 at UniProt or InterPro

Protein Sequence (248 amino acids)

>SO1359 tRNA (guanine-N1)-methyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MWLGVITLFPEMFRAVTDFGVTGRAVKNGLLELHTWNPRDFTHDRHSTVDDRPYGGGPGM
LMMVQPLRDAIHAARAAAGEDAKVIYLSPQGRKLDQQGVTELAKSSRLILVCGRYEGIDE
RIIQTEVDEEWSVGDYVLSGGELPAMTMIDAVSRLVPGVLGKQASAEQDSFSDGLLDCPH
YTRPESLDGLDVPAVLLSGNHEQIRLWRLQQSLGRTLLRRPELLQNLALTDEQSTLLAQF
VEAMDKNA