Protein Info for SO1358 in Shewanella oneidensis MR-1

Name: rimM
Annotation: 16S rRNA processing protein RimM (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR02273: 16S rRNA processing protein RimM" amino acids 9 to 176 (168 residues), 189.8 bits, see alignment E=1.2e-60 PF01782: RimM" amino acids 11 to 89 (79 residues), 88.6 bits, see alignment E=3.9e-29 PF05239: PRC" amino acids 98 to 172 (75 residues), 41.8 bits, see alignment E=1.3e-14 PF24986: PRC_RimM" amino acids 103 to 175 (73 residues), 43.7 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 100% identical to RIMM_SHEON: Ribosome maturation factor RimM (rimM) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 100% identity to son:SO_1358)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH71 at UniProt or InterPro

Protein Sequence (177 amino acids)

>SO1358 16S rRNA processing protein RimM (NCBI ptt file) (Shewanella oneidensis MR-1)
MMSSNQQPVVLGKLGSCHGIKGWLKITAYTDSVEGIFDYSPWLIKENGEWREVKVIQWRY
QGKAVVAELEGVTTRERAQMLTNCEIGILPQQMNALPEDEFYWRDLIGCEVINTTGYNMG
IVDQIVETGSNDVLLVKANAKDSFGKVERMVPFVPGQFILKVDVQGKQILVDWDPDF