Protein Info for SO1342 in Shewanella oneidensis MR-1

Name: rpoE
Annotation: RNA polymerase sigma-24 factor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 2 to 190 (189 residues), 338 bits, see alignment E=1.8e-105 PF07638: Sigma70_ECF" amino acids 9 to 186 (178 residues), 34.4 bits, see alignment E=4.2e-12 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 186 (166 residues), 111.7 bits, see alignment E=2.8e-36 PF04542: Sigma70_r2" amino acids 25 to 93 (69 residues), 69.1 bits, see alignment E=4.5e-23 PF08281: Sigma70_r4_2" amino acids 134 to 181 (48 residues), 63.6 bits, see alignment E=2.1e-21 PF04545: Sigma70_r4" amino acids 136 to 181 (46 residues), 36.5 bits, see alignment E=5.4e-13

Best Hits

Swiss-Prot: 73% identical to RPOE_SHIFL: ECF RNA polymerase sigma-E factor (rpoE) from Shigella flexneri

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 98% identity to spc:Sputcn32_1153)

MetaCyc: 73% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH87 at UniProt or InterPro

Protein Sequence (192 amino acids)

>SO1342 RNA polymerase sigma-24 factor (NCBI ptt file) (Shewanella oneidensis MR-1)
MSGQISDQQLVERVQRGDKNAFNLLVLKYQSKVISLISRYVRNQADVTDVAQEAFIKAYR
ALPNFRGESAFYTWLYRIAVNTAKNYLVSQGRRAPANDVDAEDAEYYEGSDALKEFASPE
RLMLSDEIKKVVFETLETLPEELRMAISLRELDGMSYEDIAIIMDCPVGTVRSRIFRARE
AIDKKLQPLLEE