Protein Info for SO1336 in Shewanella oneidensis MR-1

Name: nhaA
Annotation: Na+/H+ antiporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 210 to 237 (28 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 7 to 380 (374 residues), 493.4 bits, see alignment E=1.9e-152 TIGR00773: Na+/H+ antiporter NhaA" amino acids 8 to 380 (373 residues), 549.2 bits, see alignment E=2.3e-169

Best Hits

Swiss-Prot: 100% identical to NHAA_SHEON: Na(+)/H(+) antiporter NhaA (nhaA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to son:SO_1336)

MetaCyc: 59% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH93 at UniProt or InterPro

Protein Sequence (389 amino acids)

>SO1336 Na+/H+ antiporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MEKAIRNFLSQESAGGILLLIAVAFAMLMANSPLAGFYQGFLGTEVQVRVGALDLHKPLL
LWINDGLMALFFLLIGLEVKRELLEGALSSVAQASLPTFAAIGGMLVPAGIYLLFNYGDP
ITQAGWAIPAATDIAFALGIMALLGSRVPVALKVFLLALAIIDDLGVIVIIALFYSSDLS
TVSLIIASIAIVGLVALNRKGVTSLAPYGVLGLILWVAVLKSGVHATLAGVIIAFCIPLR
AKDGSSPSEHLEHSLHPWSTFLILPVFAFANAGVALGNMSLDTLMSPVPVGIALGLMLGK
PIGVMLFSFVAVKLKLAQLPDGIGWKQIAPVAAMCGIGFTMSMFIASLAFEQADPMFGDL
ARLGTLMGSIFAALIGYFWLSKVLPKKGV