Protein Info for SO1319 in Shewanella oneidensis MR-1

Updated annotation (from data): putative transporter, required for glycine utilization
Rationale: PFam PF03458.9 (UPF0126). conserved specific phenotype of UPF0126
Original annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 139 (26 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 7 to 80 (74 residues), 89.2 bits, see alignment E=6.4e-30 amino acids 94 to 165 (72 residues), 80.5 bits, see alignment E=3.4e-27

Best Hits

Swiss-Prot: 62% identical to YADS_AERCA: UPF0126 membrane protein (yadS) from Aeromonas caviae

KEGG orthology group: None (inferred from 100% identity to son:SO_1319)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHB0 at UniProt or InterPro

Protein Sequence (208 amino acids)

>SO1319 putative transporter, required for glycine utilization (Shewanella oneidensis MR-1)
MNHWIYFFDLCGTAVFALSGALAAGRHRMDPFGVIVLASVTAVGGGSIRDALIGATPVFW
IRDPNYIIVILATVVACLLLVRRPRKMPEYVLPVADALGLALFTVIGAEKALNMGLSGMI
AVVMGLITGVGGGIIRDLLCRQIPMVLRTEIYATASIIGGIGYTVSLACGMGEKTALFLA
MASALIIRLCAIKWHLSLPAFDLKTKRE