Protein Info for SO1238 in Shewanella oneidensis MR-1

Annotation: acyltransferase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 transmembrane" amino acids 232 to 249 (18 residues), see Phobius details PF19576: Acyltransf_2" amino acids 57 to 271 (215 residues), 82 bits, see alignment E=5.8e-27 PF01553: Acyltransferase" amino acids 102 to 224 (123 residues), 38.4 bits, see alignment E=1.6e-13 PF13444: Acetyltransf_5" amino acids 354 to 454 (101 residues), 90.1 bits, see alignment E=2.1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1238)

Predicted SEED Role

"Putative hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHI3 at UniProt or InterPro

Protein Sequence (619 amino acids)

>SO1238 acyltransferase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNQLTHNTPNLTKSSQLLTAPLPAEEGNAMIFTVDNVVEQNLPSLKDKPWLAKPTKAMLR
YLLNEKQCNDIANQFAYLQGIDFVEQVLASFDFSFTVPANEVENIPCEGRVVIFANHPIG
SLDGLALIKLISEIRPDIKVVANELLMALKPLHSILLPVRNMTGGTPKQHLEKIHQHLRN
EGAVLIFPSGEVSRLRPNGVRDTQWHSGFLKMAISCNAPLLPIFLDAKNSATFYGASMIY
KPLATLLLVKEMFKQAKRNMPIRIGELIPNEAVRSMDFPLKTKIKLLKNHLYRIGKDKDP
LFITQSAIAHPESRRELQAALQQCELLGETQDNKLIYLYQHQDSNPIMREIGRLREIAFR
AVGEGTGKRRDIDKYDSYYQHLVLWDKEQFEIVGAYRFASGEQVLNRYGDNALYSQSLFQ
YADDFMPFVKQGLELGRSFVQPKYWGKRSLDYLWFGIGAFLAKHPEYRYLFGPVSISNQL
PGSAREMLVHFYSTEFAPAQQLAVSMSPFGLSKKRKEQLDALYSGEDYQSHFKQLKQMLA
SMGAAVPTLYKQYGELCKQDGVKFLAFGIDADFGDCVDGLVLVDTHKLKGKRYQRYIGVH
LPEDLRNPLMAEDETEDQD