Protein Info for SO1236 in Shewanella oneidensis MR-1

Annotation: xanthine/uracil permease family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 306 to 322 (17 residues), see Phobius details amino acids 334 to 378 (45 residues), see Phobius details amino acids 390 to 419 (30 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 30 to 410 (381 residues), 246.5 bits, see alignment E=2e-77

Best Hits

Swiss-Prot: 75% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to son:SO_1236)

MetaCyc: 75% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHI5 at UniProt or InterPro

Protein Sequence (450 amino acids)

>SO1236 xanthine/uracil permease family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEQLSSTAVPSGSFLNRFFSIQQRGSTVRQEVIAGLTTFLAMVYSVIVVPNMLGKAGFD
PGAVFVATCLIAAFGSLLMGLWANLPMAIGCAISLTAFTAFGLVLGQGMSIPVTLGAIFW
MGVIFTIVSVTGIRQWVLANLPKGIAHGTGIGIGLFLLLIATNSVQLIVANDAGLPVKLG
DINSLPVIATVVGLAATIGLERRGVPGGILLVIIGLSLFGLVFDPSVKYQGLFALPNLTS
EHSLIGQLDIMGALNPVVLPIVLALVMTAIFDATGTIRAVAGQANLLDKDDNIVGGGKAL
TSDSVSSMFAGVVGGAPAAVYIESAAGTAAGGKTGLTATIVGVLFLLMVFLAPLSYLVPA
YATAPALMYVGLLMLSNVTKLDFNDKVDAMAGLTCAVFIILSCNIVTGIMLGFVTLVIGR
IFSGEWRQLKLGVLAITLGLVVFYMGGWAI