Protein Info for SO1231 in Shewanella oneidensis MR-1

Name: torD
Annotation: TorA specific chaperone (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02613: Nitrate_red_del" amino acids 49 to 171 (123 residues), 107.3 bits, see alignment E=3.3e-35

Best Hits

Swiss-Prot: 100% identical to TORD_SHEON: Chaperone protein TorD (torD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03533, TorA specific chaperone (inferred from 100% identity to son:SO_1231)

Predicted SEED Role

"Chaperone protein TorD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHJ0 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SO1231 TorA specific chaperone (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNVDINHARALVYQLLSSLFAREVNAQRLQELTSDAAQQFWTQLGHEPEFSAPVATMQK
VLNDLQRNDALLELAADYCGLFLVGTRHSASPYASLYLNSEDEPLLFGQQHQQMSEFLHQ
SKLQVQSHFPEPADHLAVMLAYMGHLACHSEDAAQLNFLDACIDSWLAKFVVKVVECDSK
HRNGFYSALASLTLAWVKQDKQLLEQTINSSVEQTLS