Protein Info for SO1204 in Shewanella oneidensis MR-1

Name: infB
Annotation: translation initiation factor IF-2 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 885 PF04760: IF2_N" amino acids 1 to 50 (50 residues), 41.2 bits, see alignment 4e-14 amino acids 308 to 358 (51 residues), 58.2 bits, see alignment 2e-19 PF08364: IF2_assoc" amino acids 59 to 97 (39 residues), 55.4 bits, see alignment (E = 2.1e-18) TIGR00487: translation initiation factor IF-2" amino acids 300 to 885 (586 residues), 937.5 bits, see alignment E=3.6e-286 PF00009: GTP_EFTU" amino acids 389 to 545 (157 residues), 125.8 bits, see alignment E=5.7e-40 TIGR00231: small GTP-binding protein domain" amino acids 389 to 541 (153 residues), 103.9 bits, see alignment E=7.4e-34 PF01926: MMR_HSR1" amino acids 390 to 495 (106 residues), 41.2 bits, see alignment E=5.7e-14 PF22042: EF-G_D2" amino acids 561 to 639 (79 residues), 104.6 bits, see alignment E=8.3e-34 PF11987: IF-2" amino acids 661 to 775 (115 residues), 147.5 bits, see alignment E=5.4e-47 PF03144: GTP_EFTU_D2" amino acids 806 to 873 (68 residues), 34.8 bits, see alignment 6.3e-12

Best Hits

Swiss-Prot: 70% identical to IF2_AERHH: Translation initiation factor IF-2 (infB) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 70% identity to avr:B565_3188)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHL5 at UniProt or InterPro

Protein Sequence (885 amino acids)

>SO1204 translation initiation factor IF-2 (NCBI ptt file) (Shewanella oneidensis MR-1)
MADTTVEKLATEVGKSVERLIEQFSQAGIKKGQADNVSEAEKQQLLDYLKKQHGGDNAPT
KMTLQRKTVSTLSVAGNGGQSKDVKVEVRKTRTFVKRDVSDAVLKAEEEAKAKAEAEAKA
KAETEAKAKAEAEAKAKVEAEAKAKAEAEAKAKAKAAAEVKVTKDTSPEAEAARIEAERL
KAAQEAATKRKQAEEAAKAAEKARLLAEENSKRWAEEERQRLEAERYSDHHITTSKVARA
AEDSSDMDEEKRGRRARNKNTAKTKRGGKDARDGREKHMRNRSTAPESMAHGFNKPVAAV
NRDVRIGETVTVAELAHLMAVKATEIIKQMMKMGSMVTINQVLDQETAQLVAEEMGHKVV
LIRENELEQQVLSERDEEGGVKLEPRAPVVTIMGHVDHGKTSLLDYIRRAKVAAGEAGGI
TQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAKATDIVVLVVAADDGVMPQTIEAIQ
HAKAGNVPLIVAVNKMDKPEADIDRVKSELSQHGVMSEDWGGDNMFAFVSAKTGAGVDDL
LEGILLQAEVLELKAVRDGMAAGVVIESQLDKGRGPVATILVQEGTLRQGDIVLCGLEYG
KIRAMKDENGRSITEAGPSIPVEILGLSGVPSAGDEATVVRDERKAREVALYRQGKFRDV
KLARQQKSKLENMFANMTEGEVKELNIVLKADVQGSLEAITDSLMGLSTDEVKVNIIARG
VGALTETDATLAAASNAIMVGFNVRADAQARKTIENESVDLRYYSVIYNLIDEVKAAMTG
MLSPEFKQQIIGLAEVRDVFKSPKLGAIAGCMVTEGTIKRSAPIRVLRDNVVIFEGELES
LRRFKDDVNEVRNGMECGIGVKNYNDVRVGDQIEVFETVEVARTL