Protein Info for SO1203 in Shewanella oneidensis MR-1

Name: nusA
Annotation: N utilization substance protein A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF08529: NusA_N" amino acids 4 to 127 (124 residues), 127.3 bits, see alignment E=9.4e-41 TIGR01953: transcription termination factor NusA" amino acids 5 to 346 (342 residues), 404.4 bits, see alignment E=3.5e-125 PF00575: S1" amino acids 136 to 199 (64 residues), 23.2 bits, see alignment E=1.8e-08 PF13184: KH_NusA_1st" amino acids 203 to 280 (78 residues), 107.8 bits, see alignment E=6.7e-35 PF26594: KH_NusA_2nd" amino acids 284 to 349 (66 residues), 79.7 bits, see alignment E=2.9e-26 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 369 to 417 (49 residues), 73.6 bits, see alignment 1.1e-24 amino acids 444 to 493 (50 residues), 61.2 bits, see alignment 7.5e-21 PF14520: HHH_5" amino acids 436 to 490 (55 residues), 36.4 bits, see alignment 1.5e-12

Best Hits

Swiss-Prot: 73% identical to NUSA_SHIFL: Transcription termination/antitermination protein NusA (nusA) from Shigella flexneri

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to son:SO_1203)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHL6 at UniProt or InterPro

Protein Sequence (499 amino acids)

>SO1203 N utilization substance protein A (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKEILLVAEAVSNEKAVPREKIFEALETALATATKKKYEGDIDVRVAIDRKTGAYETFR
RWMVIDDNGVALENPYREITLEAARFEEPEIQPGEYIEDQIESVAFDRITTQTAKQVIVQ
KVREAERAQVVEQFQDKEGELITGVVKKATRESVVVDLGNNADGVLFREDLISRESFRPG
DRVRALLYSVRPEARGAQLFLTRTKPDMLIELFRVEVPEIADELIEVMGAARDPGARAKI
AVKSNDRRIDPIGACVGMRGARVQAVSNELGGERVDIVLWDDNPAQYVINAMAPADVASI
IVDEDNHSMDIAVEAESLAQAIGRNGQNVRLATQLTGWELNVMTVEDMNKKHQAESAKVK
SLFMKSLDVDEDFAQVLADEGFTSLEEVAYVPVSELLAIDGFDEDLVEALRERAKAAIST
RALASEEALDGVEPSEELLALEGVERHLAYVLASKGIVTLEDLAEQGIDDLIEIEELTEE
KAGELIMAARNICWFGEEA