Protein Info for SO1151 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 73 to 100 (28 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 219 to 248 (30 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF05661: DUF808" amino acids 4 to 298 (295 residues), 389 bits, see alignment E=6.7e-121

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 100% identity to son:SO_1151)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHR6 at UniProt or InterPro

Protein Sequence (308 amino acids)

>SO1151 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAGASLLTLLDDIASILDDVALMSKVAAKKTAGVLGDDLALNAQQVTGVSADRELPVVWA
VALGSFRNKLILVPAAMLISAFIPWAVTPLLMFGGLFLCFEGFEKLHHSYSHRKDKHSEQ
AEPDVADISDLAAYEKEKVQGAIRTDFVLSAEIIAITLGIVADKSLSTQFFTLAVIGIVM
TVGVYGLVAAIVKMDDAGLYLSQRQGESSFTRFNRKVGFGLLSAAPLLMKSLTIIGTAAM
FMVGGGILTHGLHWVSEQIHHAEQWVSAIAVVGPVLGLLTPSVLNAFFGIAAGAVAVLLM
TGIQKLRS