Protein Info for SO1145 in Shewanella oneidensis MR-1

Name: mgtE-1
Annotation: magnesium transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 391 to 417 (27 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 12 to 452 (441 residues), 328.5 bits, see alignment E=3.3e-102 PF03448: MgtE_N" amino acids 37 to 136 (100 residues), 73.3 bits, see alignment E=3.1e-24 PF00571: CBS" amino acids 139 to 199 (61 residues), 18.6 bits, see alignment E=2.9e-07 amino acids 204 to 256 (53 residues), 36 bits, see alignment 1.1e-12 PF01769: MgtE" amino acids 325 to 447 (123 residues), 114.6 bits, see alignment E=5.7e-37

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to son:SO_1145)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHS2 at UniProt or InterPro

Protein Sequence (457 amino acids)

>SO1145 magnesium transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MNMNNNPKNTKQIVVAIQNILEQRNTAGITALAKERHPADIAAVLGSFTQPQQLQFLQLV
PAKFAADLFRYLSDELQAALVQQLDKTTLSSLLLTMAADERADLYNLLEPEQQKLLLPVL
AQAKREDMRTLAAYDKTKVGAAMTSDYTLLNSRHTAAQAIEMLRTETADKETIYQAYVVD
MLGRLIGTVSLRQLLLALPEERVVDFMKPNPIALDANALCQEAVQMIAHYDLLALPIING
KGQLVGIVTYDDAMDIASSQVDVEFTKNAAIGNIEHNLKTASIGLLYRKRVTWLVILVFG
NIFSGAGIAFFEDTIASYVSLVFFLPLLIDSGGNAGSQSATLMVRALATGEVILKDWVSL
LGRELGVAGLLGASMALAVSLLGFWRGGPEIALVVALTMQIVVIIGSLIGMSLPFLLSKL
KMDPASASAPLITSIADIIGVLVYFSIATMILDLPVV