Protein Info for SO1127 in Shewanella oneidensis MR-1

Name: dnaJ
Annotation: chaperone protein DnaJ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR02349: chaperone protein DnaJ" amino acids 5 to 349 (345 residues), 463 bits, see alignment E=4e-143 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 94.6 bits, see alignment E=4.6e-31 PF01556: DnaJ_C" amino acids 120 to 333 (214 residues), 179.7 bits, see alignment E=5.9e-57 PF00684: DnaJ_CXXCXGXG" amino acids 147 to 207 (61 residues), 65.9 bits, see alignment E=4.6e-22

Best Hits

Swiss-Prot: 100% identical to DNAJ_SHEON: Chaperone protein DnaJ (dnaJ) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to son:SO_1127)

MetaCyc: 73% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHT6 at UniProt or InterPro

Protein Sequence (378 amino acids)

>SO1127 chaperone protein DnaJ (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA
NKKAAYDQFGHAGVDPNRGGGGGYGGAGDFGDIFGDVFGDIFGGGRRGGGQRQAARGSDL
RYNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGTSATTCTTCHGQGQVQMRQGFF
TVQQPCPTCHGRGKIIKDPCAKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLAGEGEAGEF
GAPAGDLYVQVSVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKVSLKIPAET
QTGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATLTGESKKHSP
KAEGFFDGVKKFFQDLNS