Protein Info for SO1101 in Shewanella oneidensis MR-1

Name: luxS
Annotation: autoinducer-2 production protein LuxS (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02664: LuxS
  • amino acids 4 to 154 (151 residues), 213 bits, E=9.5e-68

Best Hits

Swiss-Prot: 100% identical to LUXS_SHEON: S-ribosylhomocysteine lyase (luxS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07173, S-ribosylhomocysteine lyase [EC: 4.4.1.21] (inferred from 100% identity to son:SO_1101)

MetaCyc: 75% identical to S-ribosylhomocysteine lyase (Escherichia coli K-12 substr. MG1655)
S-ribosylhomocysteine lyase. [EC: 4.4.1.21]

Predicted SEED Role

"S-ribosylhomocysteine lyase (EC 4.4.1.21) / Autoinducer-2 production protein LuxS" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.21)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage I (4/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
• autoinducer AI-2 biosynthesis I (4/5 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.21

Sequence Analysis Tools

See Q8EHW1 at UniProt or InterPro

Protein Sequence (169 amino acids)

>SO1101 autoinducer-2 production protein LuxS (NCBI ptt file) (Shewanella oneidensis MR-1)
MPLLDSFTVDHTRMNAPAVRVAKHMTTPKGDAITVFDLRFCAPNKDILSERGIHTLEHLF
AGFMRDHLNGDDVEIIDISPMGCRTGFYMSLIGVPTERQVADAWLASMEDVLKVVEQSEI
PELNEYQCGTYEMHSLEQAQDIARNIIAAGVSVNRNDDLKLSDEILGKL