Protein Info for SO1097 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 203 to 374 (172 residues), 179 bits, E=1.9e-56
• PF06325: PrmA
  • amino acids 225 to 309 (85 residues), 35 bits, E=3.4e-12
• PF03602: Cons_hypoth95
  • amino acids 231 to 323 (93 residues), 24 bits, E=8.4e-09
• PF10294: Methyltransf_16
  • amino acids 232 to 307 (76 residues), 22 bits, E=3.6e-08
• PF13847: Methyltransf_31
  • amino acids 234 to 344 (111 residues), 41.9 bits, E=2.7e-14
• PF13649: Methyltransf_25
  • amino acids 236 to 338 (103 residues), 37.4 bits, E=1e-12

Best Hits

Swiss-Prot: 100% identical to RLMG_SHEON: Ribosomal RNA large subunit methyltransferase G (rlmG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to son:SO_1097)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

See Q8EHW5 at UniProt or InterPro

Protein Sequence (377 amino acids)

>SO1097 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTQFSVAGIELELFRYPASQESNLQAWDAADEHLINSLIEGGQIAVPTAIINDSFGALS
CALSRINPNWPLRVETDARTSFLGTEQNHHRNQLPMDNLQWFTSRDTLPKDVALVLMKLP
KNLTYFAHQLMRLSQILPAGCRVLVGAKAKSINSSLLALFAKHLGPANASLAWKKTRVIT
CISDGKPRALPNGITWNIPEFNLTISNLSNVFAANKLDIGARIMLDNLPQGKFNTVVDLG
CGNGVLGLRAAQLYPNADIHFIDDSEMAVASAKANWTMNQLAEGKGHFHWDDCMTHLPED
IEPDLVLCNPPFHQGEAITDHIAWQMFLDARRRLKNGGILHIVGNRHLAYHVKLQRLFKN
CTTVASNGKFVILQAQK