Protein Info for SO1038 in Shewanella oneidensis MR-1

Name: cobQ
Annotation: cobyric acid synthase CobQ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF13500: AAA_26" amino acids 1 to 230 (230 residues), 57.6 bits, see alignment E=2.4e-19 PF01656: CbiA" amino acids 1 to 231 (231 residues), 82.3 bits, see alignment E=4.4e-27 TIGR00313: cobyric acid synthase CobQ" amino acids 1 to 498 (498 residues), 473.2 bits, see alignment E=4.7e-146 PF07685: GATase_3" amino acids 251 to 457 (207 residues), 186.9 bits, see alignment E=4.9e-59

Best Hits

Swiss-Prot: 100% identical to COBQ_SHEON: Cobyric acid synthase (cobQ) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to son:SO_1038)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI15 at UniProt or InterPro

Protein Sequence (510 amino acids)

>SO1038 cobyric acid synthase CobQ (NCBI ptt file) (Shewanella oneidensis MR-1)
MVQGTTSDAGKSTLVAGICRLLARQGVNVAPFKPQNMALNSAVTVDGGEIGRAQALQAAA
CYLVPHTDFNPILLKPSSDTGAQIIVQGKALTTLEASAFFGEKSKDYKAMALNAVLDSFE
RLGQQYHTIVVEGAGSPAEINLRAGDIANMGFAEAVDCPVIIIADIDKGGVFAHLVGTLA
LLSESEQARVKGFVINRFRGDISLLQSGIDWLEAYTQKPVLGVLPYLHDLHLDAEDALTD
SPTKQAKSCFKVRVLVYPRTSNHTDVDPLRLHPDIDFDYVSLQTQALAQTPEIAADLLIL
PGSKNVRADLAFLREQGWDKQIAKHLRYGGKVLGICGGYQMLGERIADPLAIEDVFGTSQ
GLGYLPISTEFKAEKQLRCVAGELTLIGQTVAVKGYEIHCGESQYLTSSDAAKGAPLRLI
NELTCDEQAEKSFADGCLSEDGQVLGTYLHGLFDSPDACQLILRWAGLEDAQAIDINAIR
EQQLDRLADVLAEHLDLPQLQAILTASVKP