Protein Info for SO1036 in Shewanella oneidensis MR-1

Name: cobS
Annotation: cobalamin 5'-phosphate synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 191 to 220 (30 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 12 to 251 (240 residues), 119.5 bits, see alignment E=1e-38 PF02654: CobS" amino acids 17 to 252 (236 residues), 191.6 bits, see alignment E=1e-60

Best Hits

Swiss-Prot: 100% identical to COBS_SHEON: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to son:SO_1036)

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI17 at UniProt or InterPro

Protein Sequence (262 amino acids)

>SO1036 cobalamin 5'-phosphate synthase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSERESWHKEIDLFFVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIIFW
LTQNWLPAGVSVLLSMLTGILLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG
ALALIMVLLLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTETYVRDDETSKSK
PLAQHQGINDLFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL
GAAQQICEIVCYFVLLVVGGIL