Protein Info for SO1034 in Shewanella oneidensis MR-1

Annotation: iron-compound ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details PF01032: FecCD" amino acids 33 to 375 (343 residues), 276.6 bits, see alignment E=1.2e-86

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to son:SO_1034)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI19 at UniProt or InterPro

Protein Sequence (380 amino acids)

>SO1034 iron-compound ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MISRLKLITLLTPIFTPLTRQQWLMLALVGFTLLTPIAAASFGAANISFLDVFNVFIDKF
SQLFMGENAPSTAAMTDRIVMELRLPRILLAFVAGAGLSLAGSVLQTVTRNPLADPYLFG
ISSGASFGAVVMLTLFSGSGFFANAGVIANSGIFSGAEILAGLQWFSLPFGAFIGASLSV
LIVLALSGLGLNSQVERMLLSGVATSFMFGALTSLLLYFASPQATASVLFWSLGSFAKAS
WSLLILPTIVVLVSFFIILGWKRQIMALQAGDETAHTLGVNVPKLRLNMLLLCSLITAIL
VATCGGIGFVGLMIPHTVRLLFPGRQPILLTALVGGLFMVWIDVLARCLLGNQELPVGII
TASIGSFFFLLILRRRKVAS