Protein Info for SO1033 in Shewanella oneidensis MR-1

Annotation: iron-compound ABC transporter, ATP-binding protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00005: ABC_tran" amino acids 18 to 167 (150 residues), 120.1 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 40% identical to FHUC_ECOLI: Iron(3+)-hydroxamate import ATP-binding protein FhuC (fhuC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to son:SO_1033)

MetaCyc: 40% identical to iron(III) hydroxamate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI20 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SO1033 iron-compound ABC transporter, ATP-binding protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MALNVSQLSWTIEGKTILSGVNFALQRGEMLGLIGPNGAGKSSLLRCLYRFIRPTQGQIS
LFSQDISQLSPKAFACKVAVVQQDTPHYFDMTTEQLVAMGLTPHKGMFDSHSSGDSDKII
KALEKVGLSHKLHQQYERLSGGEKQRALIARAIVQQPLLLILDEPTNHLDVRYQIQILEL
VRSLGISVIASIHDLNLASALCDSLLLLDNGQVSAMGTPTEVLTEERIAQVFGVCAQVMP
HPQHANPLINYFYGYQKSYGYQKSKTDEEGAIHPPHIINGVKTPS