Protein Info for SO1021 in Shewanella oneidensis MR-1

Name: nuoA
Annotation: NADH dehydrogenase I, A subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details PF00507: Oxidored_q4" amino acids 24 to 121 (98 residues), 119.2 bits, see alignment E=3.9e-39

Best Hits

Swiss-Prot: 100% identical to NUOA_SHEON: NADH-quinone oxidoreductase subunit A (nuoA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 100% identity to son:SO_1021)

MetaCyc: 66% identical to NADH:quinone oxidoreductase subunit A (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI29 at UniProt or InterPro

Protein Sequence (134 amino acids)

>SO1021 NADH dehydrogenase I, A subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MFADISAQHWAFAIYVIGAIAICLTMIGLAALLGGRAQGRTKNKPFESGVDSVGTARLRF
SAKFYLVAMFFVIFDVEALYLFAWSVSVRESGWVGFIEATIFIGLLLIGLVYLWRIGALE
WSPRKPQLNNKNTD