Protein Info for SO1007 in Shewanella oneidensis MR-1

Annotation: hypothetical Na+/H+ antiporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 16 to 45 (30 residues), see Phobius details amino acids 55 to 65 (11 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 161 to 188 (28 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 387 to 413 (27 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 473 to 513 (41 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 165 to 491 (327 residues), 263.5 bits, see alignment E=1.3e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1007)

Predicted SEED Role

"Predicted lysine transporter, NhaC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EI43 at UniProt or InterPro

Protein Sequence (526 amino acids)

>SO1007 hypothetical Na+/H+ antiporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MEISHFADSGWSVLPPLLAVALAIITRRVLLSLGVGIVAGSLLLNQFSPFDSLHYMFNTV
LRIFWVDGALNRDNINMLLFMLLLGGLISLMSVSGATRAFAEWAAKRAKTRRGAKGLTGI
MVFAFFIDDFFHSLSVGAICRPVTDRFQISRAKLAYLLDSTAAPVCVLMPISSWGAYIIA
LVGGIMAAHGITDQSPISAFVEMIPMNLYAVFTLLMVLVVIAFQLDIGSMRWHEERALQG
KLWDESKGRPIGLDMESPEDSNGGMIDMVLPIFTLTAATVYFMIDSGAAVLSAQGLPFSV
LGSFENTNVGSSLVYGALCSLGVSIALALRLKLGAKNWIKAAPQGVMAMLPAINILLFAW
AIGAVVRDVETGKYLASLANGNLPIEVLPAVVFVLSCAMAFATGTSWGTFGIMLPLAGDM
AAASDISLMLPMLAAVLAGSVFGDHSSPISSTSILSATGAGCHHIDHVMTQLPYALAMAF
GAALGYLAMGFMHSTLAGVCVSALWFILFSAYHLQKAKTRQALASA