Protein Info for SO0931 in Shewanella oneidensis MR-1

Name: epd
Annotation: D-erythrose-4-phosphate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00044: Gp_dh_N" amino acids 2 to 104 (103 residues), 118.8 bits, see alignment E=1.2e-38 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 3 to 327 (325 residues), 540 bits, see alignment E=1.1e-166 PF02800: Gp_dh_C" amino acids 159 to 315 (157 residues), 184.5 bits, see alignment E=1.1e-58

Best Hits

Swiss-Prot: 100% identical to E4PD_SHEON: D-erythrose-4-phosphate dehydrogenase (epd) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 100% identity to son:SO_0931)

MetaCyc: 66% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIB2 at UniProt or InterPro

Protein Sequence (338 amino acids)

>SO0931 D-erythrose-4-phosphate dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MIRVAINGYGRIGRSILRALYESGKRQQIQIVAINELAKPEAIIHLTQYDTTHGRFQPRV
KLVDGQMQIGDDTIKIFHEPDPAKLPWRELDIDIVYEATGAILDRQSCEAHIHAGAKQVL
ISHPSSADVDGTIVYGVNHDLLRAEHTVVSNASCTTNCIVPVIDVLDKHFGVKSGAITTI
HSAMNDQQVIDAYHDDLRRTRAAGQSIIPVDTKLARGIERILPHMKDKFEAISVRVPTIN
VTAIDLSVTLDKTVDIATVNQVLELAANGRFNGILGYTDEPLVSCDFNHDPRSSIVDGTQ
TRVSAGQLVKLLLWCDNEWGFANRMLDTSLAMIAAKQS