Protein Info for SO0929 in Shewanella oneidensis MR-1

Name: metK
Annotation: S-adenosylmethionine synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 4 to 101 (98 residues), 150 bits, E=3.6e-48
• TIGR01034: methionine adenosyltransferase
  • amino acids 5 to 378 (374 residues), 648.2 bits, E=2e-199
• PF02772: S-AdoMet_synt_M
  • amino acids 114 to 231 (118 residues), 160.8 bits, E=2.2e-51
• PF02773: S-AdoMet_synt_C
  • amino acids 233 to 369 (137 residues), 235.8 bits, E=1.9e-74

Best Hits

Swiss-Prot: 100% identical to METK_SHEON: S-adenosylmethionine synthase (metK) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to son:SO_0929)

MetaCyc: 86% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage I (4/4 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• L-methionine degradation I (to L-homocysteine) (1/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)
• superpathway of L-methionine salvage and degradation (4/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See Q8EIB4 at UniProt or InterPro

Protein Sequence (383 amino acids)

>SO0929 S-adenosylmethionine synthetase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTS
AWVDIEELTRKTVREIGYIHSDMGFDADSCAVLNAIGKQSPDINQGVDRADPKEQGAGDQ
GLMFGYASNETDILMPAPITYAHALVKRQSEVRKNGTLPWLRPDAKSQVTFAYEDNKIVG
IDAIVLSTQHSPDIAQADLIEGVMETIIKPVLPAQWLNKDTKYFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVS
YAIGVAEPTSISVETFGTGKVSEEVLIKLVRQHFDLRPYGLTEMLNLARPIYQATAAYGH
FGRSEFPWEATDKAEALRADAAL