Protein Info for SO0917 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein TIGR00258 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01931: NTPase_I-T
  • amino acids 8 to 176 (169 residues), 207.2 bits, E=7.2e-66
• TIGR00258: inosine/xanthosine triphosphatase
  • amino acids 10 to 179 (170 residues), 130.9 bits, E=2.5e-42

Best Hits

Swiss-Prot: 100% identical to NCPP_SHEON: Inosine/xanthosine triphosphatase (SO_0917) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_0917)

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See Q8EIC6 at UniProt or InterPro

Protein Sequence (179 amino acids)

>SO0917 conserved hypothetical protein TIGR00258 (NCBI ptt file) (Shewanella oneidensis MR-1)
MQQNIIKVIVGSKNPVKVNAAANAMTLLFPEYQIQTIGMDAPSGVPAQPMTDSDTRQGAI
NRVNYCQQHAEADYYFAMEGGVDHFEFGPATFAYIAIAHQQRLSIGRGALLPLPRQVYQA
LEAGEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQALILAMAPFLNPEIYL