Protein Info for SO0895 in Shewanella oneidensis MR-1

Annotation: pirin family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF02678: Pirin" amino acids 29 to 118 (90 residues), 106.2 bits, see alignment E=9.2e-35 PF05726: Pirin_C" amino acids 179 to 282 (104 residues), 92.4 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: K06911, (no description) (inferred from 100% identity to son:SO_0895)

Predicted SEED Role

"Pirin-like protein YhhW, possibly qercetin 2,3-dioxygenase activity"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIE7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SO0895 pirin family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKVLGQFSAKPAMDGDGVNIRRVADFISTQFDPFLMMDEIKSDDKQDVIGGFPPHPHRGM
ETFTYIRKGGFEHRDQMGNVKAIRTGDVQWMSTGYGVVHSEMPLADALNGLHGFQIWVNM
PAKDKLRPATYQDTASIPSVETTNDTGATLKALAGDWAFAGKSTISATIQGLAGEAAIAD
LMINANGEAQLDLSKHEFAALYIYQGGLSKGEGSQWSFNEGQFLVLDSQTPLQLKADDRG
AGMLLFVGKPIREKIVQMGPFVMNTQAEIQQAIRDYQEGRFGQIA