Protein Info for SO0869 in Shewanella oneidensis MR-1

Name: panC
Annotation: pantoate--beta-alanine ligase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00018: pantoate--beta-alanine ligase" amino acids 6 to 277 (272 residues), 337.4 bits, see alignment E=5.3e-105 PF02569: Pantoate_ligase" amino acids 6 to 277 (272 residues), 364.2 bits, see alignment E=1.8e-113 TIGR00125: cytidyltransferase-like domain" amino acids 24 to 67 (44 residues), 36.6 bits, see alignment 4e-13

Best Hits

Swiss-Prot: 100% identical to PANC_SHEON: Pantothenate synthetase (panC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to son:SO_0869)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIH0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>SO0869 pantoate--beta-alanine ligase (NCBI ptt file) (Shewanella oneidensis MR-1)
MITSAHIDDIRTQVRAWRAKGETVAFVPTMGNLHQGHITLVKEAAKKCDHVVASIFVNPM
QFGQNEDLDAYPRTLEADSQALTAAGAELLFTPTPAIIYPKGLAQQTYVEVPGISDVLCG
ASRPGHFRGVATIVCKLFNIVQPDIAFFGNKDYQQLLVIRTMVEDLSLPIEIIGIDTIRE
ASGLAMSSRNGYLTAQEKAAAPALKKAIDAMAQGIKQGISIEQVTEEAKASLTAAGFTPD
YLEVRHADTLAKAETQDKALVILAAAYLGKARLIDNLRFDR