Protein Info for SO0867 in Shewanella oneidensis MR-1

Annotation: serine protease, subtilase family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 818 PF22148: Fervidolysin_NPro-like" amino acids 8 to 93 (86 residues), 27.2 bits, see alignment E=1.1e-09 PF00082: Peptidase_S8" amino acids 140 to 403 (264 residues), 184 bits, see alignment E=1e-57 PF01483: P_proprotein" amino acids 569 to 647 (79 residues), 85.8 bits, see alignment E=4.3e-28 PF18911: PKD_4" amino acids 654 to 734 (81 residues), 74.1 bits, see alignment E=1.9e-24 PF00801: PKD" amino acids 665 to 729 (65 residues), 52.4 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0867)

Predicted SEED Role

"Serine protease, subtilase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIH2 at UniProt or InterPro

Protein Sequence (818 amino acids)

>SO0867 serine protease, subtilase family (NCBI ptt file) (Shewanella oneidensis MR-1)
MSAVPAMAKDAPVYEKDAILVVYKDNATKAERSAAQRLIRGTLTDVNADGVDDKFPHLLN
GKLARLALRKGANIEDAIKVISRHPAVKYAEPNYIIKAIGTPDDPSFASLWGMNNTGQSG
GTADADIDAPEAWEITTGSSDVVIGVIDTGVDYNHPDLQANMWVNAGEIAGNGIDDDANG
VIDDIHGYSAVNNNGNPMDGNGHGTHVSGTIGAKGNNGVGVVGVNWDVKIAGCQFLDTDG
YGSTAGAIACIDYFTNLKVNHGVDIKATNNSWGGGGFSQALKDAIEAGGEAGILFVAAAG
NDAVDNDASPHYPSSYNSDVVFSIASTTRNDRMSDFSQWGLTSVDMGAPGSAILSTVRGG
GYATYSGTSMATPHVTGAAALVWALNPDLTPVEMKELLMASGDANADLTGKTVAGTRLNV
ANALEQANPSPSYKFTVSPASQSVEAGSAASYNFSVGSVAGWDGDVALTVSVSPALEGVS
LSSSTVSAGGSFTLNVATTAQTVWGDYSITVTGNDGAIEKSKVVSLNVFPQGLNDFTYGN
ENSVAIPDNNPNGVISTIEVADDVQIFGVLADVNISHTWIGDLRVVLTSPAGTQVVLHNR
DGGSADNIVKSWDLSAFDGENVRGTWSLSVDDNVGSDTGTLNNWGLVISGLGEASPAAPV
AGFEFAVEGLGVAFTNTSTDANDDIVSYSWDFGDGTNSTEMNPSHVYTSAGTYTVSLTVT
DSMDHSNTVTMPVQVYEHNINAAVSRALVSRRGSAMVDLTWDSALGENVALYRNGELVVT
TENDGSYRDRFTTTASSVTYQVCETTGTLCSAPVVAQF