Protein Info for SO0858 in Shewanella oneidensis MR-1

Annotation: sodium:alanine symporter family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 235 to 236 (2 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 15 to 438 (424 residues), 505.1 bits, see alignment E=7.7e-156 PF01235: Na_Ala_symp" amino acids 52 to 441 (390 residues), 461 bits, see alignment E=2.1e-142

Best Hits

Swiss-Prot: 61% identical to Y883_HAEIN: Uncharacterized transporter HI_0883 (HI_0883) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to son:SO_0858)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EII1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>SO0858 sodium:alanine symporter family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNFQALLSSLNGIVWGPITLCLLVGTGVYLTTRLKLIQVFRLPMALSLLFKPAKGHGDLS
SFAALCTALSATIGTGNIVGVATAIKMGGPGALFWMWLAAFFGMATKYAECMLAVKYRTT
DARGQIAGGPMYYIERGLGLRWMAKLFALFGVGVAFFGIGTFAQVNAISDALTIAFDVPT
WTTALVLTLLVAAVTLGGVKRISNVAQKLVPAMSIGYVLACVWILLGFAEAILPALQLVV
ESAFTPVSAAGGFLGATVAQAIQMGIARGVFSNESGLGSAPIAAAAAKTNEPVEQGLVSM
TGTFFDTIIICTMTGLVLIITGVWSGDTAGAAMTSAAFSLGGSAAIGQYLVTIALVCFAF
TTILGWHYYGERCWYYLVGERGLRAYQIVFLGLIAGGAFIKLDVIWLLADTVNGLMAIPN
LIAIIGLRHIIIAETQSYFVRTFTNSTLNPIY