Protein Info for SO0847 in Shewanella oneidensis MR-1

Name: napG
Annotation: iron-sulfur cluster-binding protein NapG (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR00397: MauM/NapG family ferredoxin-type protein" amino acids 14 to 222 (209 residues), 264.8 bits, see alignment E=2.6e-83 PF12800: Fer4_4" amino acids 65 to 80 (16 residues), 20.9 bits, see alignment (E = 1.9e-07) amino acids 190 to 202 (13 residues), 12.5 bits, see alignment (E = 9.7e-05) PF00037: Fer4" amino acids 65 to 82 (18 residues), 28.1 bits, see alignment (E = 7.4e-10) PF12838: Fer4_7" amino acids 67 to 121 (55 residues), 34.3 bits, see alignment E=1.4e-11 amino acids 152 to 202 (51 residues), 30.4 bits, see alignment E=2.4e-10 PF12798: Fer4_3" amino acids 67 to 80 (14 residues), 17.9 bits, see alignment (E = 2.4e-06)

Best Hits

Swiss-Prot: 53% identical to MAUM_PARDP: Methylamine utilization ferredoxin-type protein MauM (mauM) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K02573, ferredoxin-type protein NapG (inferred from 100% identity to son:SO_0847)

Predicted SEED Role

"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIJ2 at UniProt or InterPro

Protein Sequence (244 amino acids)

>SO0847 iron-sulfur cluster-binding protein NapG (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQQVKSAFTAKQVNRRQFLATTAKAGCVMGLVGLGLTATAKSQGQLAPQACRPPGALEE
SDFLSACVRCGLCVEACPYDTLTLARWFDGAATGTPFFTARHIPCEMCEDIPCIKACPSG
ALDPQLEHISDAKMGIAVLIDEKNCLNFKGLRCDVCYRVCPLIDNAITLERQRNQHSDHH
AMFLPTVNSDTCTGCGKCEHACVLDTAAIKVLPTALALGKSAEHDTYLNTEETTLEMLNK
GLTL