Protein Info for SO0841 in Shewanella oneidensis MR-1

Annotation: GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 273 to 295 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 47 to 262 (216 residues), 57.7 bits, see alignment E=1.1e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 324 to 484 (161 residues), 151.7 bits, see alignment E=7.4e-49 PF00990: GGDEF" amino acids 329 to 481 (153 residues), 146.7 bits, see alignment E=5.5e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0841)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIJ8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>SO0841 GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MYLRSYMGWRFWALFFCLCSPSSVSAERLASSYLKVTEEAASSRQLIRYCVDPDWLPYEA
IREGEHVGISSDYIRYIESHSNFKFSLVPTTSWSETLNFLQTGRCELTPMLNKTATREQF
LHFSHVYFHSPNVLVSLKEQPFLQGFENIGSRTLAVPKGYRLAEYIQHYYPKVKIIEVGS
EPAGLEAVLDKRADLFVGSMFSVNAYIQQTGFNHLKIAGWGGPEDELRMGVSLGHEALLP
ILNQVLDDVDELERIRIYQKWNNITVIDETNYLLIYQVIVGTLLVVFLLATRTFFISRYN
RRLTDKNEQLEALRLRLEHTNAELEFLSTHDPLTKLYNRHYFNRQFVHEHRSEISSEGAI
CLVMLDIDFFKEINDTLGHAVGDNILMELSGVLQHCVRETDVVARWGGEEFVILCHQTSI
DLVKTLCQRIAAAIKDYRFSGNVQLTCSFGIAKLVNNEPMQSCFERADKALYQAKALGRN
QICVDEFNT