Protein Info for SO0822 in Shewanella oneidensis MR-1

Annotation: outer membrane efflux family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 22 to 462 (441 residues), 269.9 bits, see alignment E=2.1e-84 PF02321: OEP" amino acids 75 to 255 (181 residues), 111.1 bits, see alignment E=2.7e-36 amino acids 283 to 462 (180 residues), 89.1 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0822)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIL7 at UniProt or InterPro

Protein Sequence (472 amino acids)

>SO0822 outer membrane efflux family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNNKVLMHQNKLRTLKLSVIAISIALLSGCGALMRSDFEPPALQVPEQWQHTAVNSQVSL
DPWWQKFNQPELNQLISQVLSSNNDLTIATLTLQKARLQAGLARDELYPQLSSNNAASVN
KPLEGGSSSKAYKANLSVSYEVDLWGKVSANIDQAQWTALASVEDRESTAHSLVATTASL
YWQIGYLHQRIELSNKSIEYSRQTLALTERQYASGAVTELNVLESLRSLAGQEAAHSQLL
QQLVEAENALAILLNRAPGQVAVEIKQLPDSAVPEIGVGIPADLIGRRPDVKAALYQLRS
ALASKNATYASYFPSLSLTGSVGESTSELKELLRNPVGSLGAGLMLPFLQWNQMQINNDL
ADIDYQTAIVNYRKTLYSAFEDVDNAISAKQQYAYQGEKLEQQFSAAAQAEAIYESQYRH
GAIGIQNWIDAQENRRSAEAALLENRYNQLTAQATLYQALGGSDIAPLLADN