Protein Info for SO0821 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding/permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 276 to 297 (22 residues), see Phobius details amino acids 529 to 555 (27 residues), see Phobius details amino acids 580 to 607 (28 residues), see Phobius details amino acids 615 to 639 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 112.4 bits, see alignment E=5.3e-36 PF12704: MacB_PCD" amino acids 276 to 497 (222 residues), 153.5 bits, see alignment E=2e-48 PF02687: FtsX" amino acids 535 to 649 (115 residues), 74.5 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 100% identical to MACB_SHEON: Macrolide export ATP-binding/permease protein MacB (macB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to son:SO_0821)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIL8 at UniProt or InterPro

Protein Sequence (656 amino acids)

>SO0821 ABC transporter, ATP-binding/permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKPLLEVSACYRSFQAGEQQLTVLKDINLSIARGEMVAIVGASGSGKSTLMNILGCLDK
PSKGAYFIDGQDTSQMDVDELAKLRREHFGFIFQRYHLLGDLNAVGNVEVPAVYAGKDRL
ERRDRAESLLSRLGLGERLDHKPNQLSGGQQQRVSVARALMNGGDVILADEPTGALDSHS
GEEMMRLLQELHREGHTIIIVTHDMHVAQHADRIIEIKDGVIISDEPNLASQTAVKAQVD
MSLAKPSGATRVAAWDRYAEALKMALLAMSTHRLRTFLTMLGIIIGIASVVSVVALGEGS
QREILKSISSMGTNTIDIRPGLGFGDRRSARVRTLTASDANALKNLPYVDSVTPSISSSV
TVRLGNKAVTASVNGVGPEFFRVRGYELAQGQFWDDDSVDALAQDAVIDDNTRKQLFPDS
TGAMGSVIGQVIFLGDLPVRIIGVTKPKESAFGNSDALNVWVPYTTVSGRMVGKKYLDGI
TVRLDESVPSNAAEQGIITLLKMRHGTQDFFTINTDTIRQNIEKTTATMTLLISAIAVIS
LVVGGIGVMNIMLVSVTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGALGVALAY
LIGVVFAQAGGSFQMIYSTTSIVAAFACSTLIGVLFGFLPARNAARLDPVEALARE