Protein Info for SO0811 in Shewanella oneidensis MR-1

Annotation: inosine-uridine preferring nucleoside hydrolase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF01156: IU_nuc_hydro" amino acids 5 to 300 (296 residues), 344.9 bits, see alignment E=2.6e-107

Best Hits

Swiss-Prot: 100% identical to RIHA_SHEON: Pyrimidine-specific ribonucleoside hydrolase RihA (rihA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01250, pyrimidine-specific ribonucleoside hydrolase [EC: 3.2.-.-] (inferred from 100% identity to son:SO_0811)

MetaCyc: 72% identical to pyrimidine-specific ribonucleoside hydrolase RihA (Escherichia coli K-12 substr. MG1655)
Uridine nucleosidase. [EC: 3.2.2.3]; 3.2.2.3 [EC: 3.2.2.3]

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.-.- or 3.2.2.1 or 3.2.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIM7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SO0811 inosine-uridine preferring nucleoside hydrolase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTCPIILDCDPGHDDAIALILALAHPDLVPLAVTTSAGNQTPDKTLNNALRILTLLNRSD
IPVAGGAAKPLARDLIIADNVHGETGLDGPALPNPSFSPQAITAVELMAQQIRKSHQPVT
LIPTGPLTNIALLLASHSELHDKIERIVLMGGAAGVGNWTPAAEFNIFVDPEAADIVFKS
GIPITMCGLDVTHQAQIMDEDIERIRAIPNPVAKCVAELLDFFMIYHRDPKWGFVGAPLH
DPCTIAWLLKPELFDAQDCWVGIETQSELTLGMTVVDRYQLTGKPANATVLFGLNRQGFV
DLLVHSLAAYTPTYLNRR