Protein Info for SO0810 in Shewanella oneidensis MR-1

Name: rbsK
Annotation: ribokinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF00294: PfkB" amino acids 1 to 296 (296 residues), 230.4 bits, see alignment E=3.2e-72 TIGR02152: ribokinase" amino acids 4 to 302 (299 residues), 386.4 bits, see alignment E=4.7e-120 PF08543: Phos_pyr_kin" amino acids 176 to 280 (105 residues), 40.7 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 49% identical to RBSK_ECO57: Ribokinase (rbsK) from Escherichia coli O157:H7

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to son:SO_0810)

MetaCyc: 49% identical to ribokinase (Escherichia coli K-12 substr. MG1655)
Ribokinase. [EC: 2.7.1.15]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15); Ribokinase in cluster with nucleoside hydrolase (EC 2.7.1.15)" (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIM8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>SO0810 ribokinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSHILVIGSANADHVMNFEYLPVPGQTLKSRSYRLEHGGKGANQAVACARLCLPDSRVDF
ICHLGQDSIGNEMRDSWLKDGIQAEGITLVDNVSTGTAMIFVADNGENAIGIAAGANAHL
TPLELEKHYALFANAQYLLIQLETPTETVSNALQMAKRLGITTVLNPAPAATQELDYLKW
VDIITPNETEAEALTGIEVKHEEDAKLAAQWLHQQGITTVVITLGSKGAFISSPGFTGLI
PALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVSFANAASAITVTREGAQRAIPYRSE
VSR