Protein Info for SO0807 in Shewanella oneidensis MR-1

Name: hpt-1
Annotation: hypoxanthine-guanine phosphoribosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 19 to 163 (145 residues), 40.1 bits, E=1.2e-14

Best Hits

KEGG orthology group: K07101, (no description) (inferred from 98% identity to shm:Shewmr7_0642)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage III (4/4 steps found)
• superpathway of guanine and guanosine salvage (3/3 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.8

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See Q8EIN0 at UniProt or InterPro

Protein Sequence (188 amino acids)

>SO0807 hypoxanthine-guanine phosphoribosyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEKYFVTAQQLLEDSFLLASQVYESGFRPQFIVGIWRGGAPIGIAVQEFFDFKQVETDH
IAVRTSSYYGIGTDKQSKEIKVHGLHYIVENANASDSLLIVDDVFDSGRSIHALKEKLGQ
LMRLNMPKDIRIACPYYKPKNTAVPLKPDYYIHASEDWLVFPHEVTGLTPEEIAEGKGDL
KNIQHLFK